« Back
Home /
Recombinant Human Serpin A1/Alpha-1-antitrypsin Protein

Recombinant Human Serpin A1/Alpha-1-antitrypsin Protein

Item no.	RP00287-100ug
Manufacturer	Abclonal
Amount	100 ug
Quantity options	100 ug 200 ug 20 ug 500 ug 50 ug
Category	Peptides & Proteins Recombinant Proteins Cardiovascular Research Hypertension
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 97% by SDS-PAGE.
Sequence	EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLP
NCBI	Serpin A1/Alpha-1-antitrypsin
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	A1A,A1AT,AAT,PI,PI1,PRO2275,alpha1AT,SERPINA1,A1AT,AAT,PI,PI1,PRO2275,alpha1AT
Similar products	AAT, PI1, PI, A1A, A1AT, MGC23330, MGC9222, PRO2275, SerpinA1, alpha1AT
Shipping Condition	Cool pack
Available
Manufacturer - Applications	< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	45.16 kDa
Manufacturer - Additional Information	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant Human Serpin A1/Alpha-1-antitrypsin Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu25-Lys418) of human alpha 1 Antitrypsin (Accession #NP_000286.3) fused with a 6×His tag at the C-terminus.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Glu25-Lys418
Route	C-His
Endotoxin	< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Other Recombinant Protein
Antigen Seq	EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
Bioactivity	Measured by its ability to inhibit trypsin cleavage of a fluorogenic peptide substrate, Mca-RPKPVE-Nval-WRK(Dnp)-NH2. The IC50 value is approximately <0. 4 nM.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	45.16 kDa
Gene Symbol	Serpin A1/Alpha-1-antitrypsin

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP00287-100ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 8/14/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer