« Back
Home /
Recombinant Human E-selectin/SELE/CD62E Protein

Recombinant Human E-selectin/SELE/CD62E Protein

Item no.	RP00293-20ug
Manufacturer	Abclonal
Amount	20 ug
Quantity options	100 ug 10 ug 20 ug 500 ug 50 ug
Category	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Neural Signaling Neural Adhesion Molecules By Cell Type Hematology Leukemia Peptides & Proteins Recombinant Proteins Cell Biology Cell Movement Cell Adhesion
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 97% by SDS-PAGE.
NCBI	SELE/E-selectin/CD62E
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	SELE,CD62E,ELAM,ELAM1,ESEL,LECAM2
Similar products	ELAM1, CD62E, LECAM2, ELAM, ESEL
Shipping Condition	Cool pack
Available
Manufacturer - Applications	Please contact us for more information.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	59.48 kDa
Description	Recombinant Human E-selectin/SELE/CD62E Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Trp22-Pro556) of human E-Selectin/CD62E (Accession #NP_000441.2) fused with a 6×His tag at the C-terminus.
Background	The protein is found in cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. It exhibits structural features such as the presence of lectin- and EGF-like domains followed by short consensus repeat (SCR) domains that contain 6 conserved cysteine residues. These proteins are part of the selectin family of cell adhesion molecules. Adhesion molecules participate in the interaction between leukocytes and the endothelium and appear to be involved in the pathogenesis of atherosclerosis.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Trp22-Pro556
Route	C-His
Manufacturer - Research Area	Bio-Markers & CD Antigens, Biosimilar Drug Targets
Revised name	CD62E, ELAM, ELAM1, ESEL, LECAM2
Antigen Seq	WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIP
Bioactivity	Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. When 5 x 104cells/well are added to human E-Selectin/His Chimera coated plates (2 μg/mL with 100 μL/well), approximately 40-50% will adhere after 1 hour incubation at 37°C.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	59.48 kDa
Gene Symbol	SELE/E-selectin/CD62E

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP00293-20ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer