Item no. |
RP00300-1000ug |
Manufacturer |
Abclonal
|
Amount |
1000 ug |
Quantity options |
1000 ug
100 ug
200 ug
20 ug
500 ug
50 ug
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
Human (Homo sapiens) |
Host |
Human |
Purity |
> 97% by SDS-PAGE. |
NCBI |
NKG2D ligand 2/ULBP2 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
ULBP2,ALCAN-alpha,N2DL2,NKG2DL2,RAET1H |
Similar products |
N2DL2, RAET1H, ALCAN-alpha, NKG2DL2, UNQ463 / PRO791 |
Shipping condition |
Cool pack |
Available |
|
Manufacturer - Applications |
< 0.1 EU/μg of the protein by LAL method. |
Manufacturer - Category |
Proteins |
Shipping Temperature |
ice pack |
Storage Conditions |
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week. |
Protein Weight |
22.57 kDa |
Description |
Recombinant Human NKG2D ligand 2/ULBP2 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gly26-Ser217) of human ULBP-2 (Accession #NP_079493.1) fused with a 6×His tag at the C-terminus. |
Background |
ULBP2 Protein, Human, Recombinant (His Tag) consists of 203 amino acids with a molecular weight of 23.2 kDa. The apparent molecular mass of recombinant human ULBP2 is about 33 kDa in SDS-PAGE under reducing conditions because of glycosylation.NKG2D ligand 2 is cell membrane protein belonging to theMHC class I family.The gene for ULBP-2 resides in a cluster of ten related genes, six of which encode potentially functional glycoproteins. ULBPs are known to bind to human NKG2D, an activating receptor expressed on NK cells, NKT cells, gamma δ T cells, and CD8+ alpha beta T cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands to NKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transduction pathway.ULBP2 / N2DL-2 is not expressed in normal tissues, but in various types of cancer cell lines and the fetus and has been implicated in tumor surveillance. |
Manufacturer - Cross Reactivity |
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles. |
Immunogen |
Gly26-Ser217 |
Route |
C-His |
Manufacturer - Research Area |
Other Recombinant Protein |
Revised name |
ALCAN-alpha, N2DL2, NKG2DL2, RAET1H, UNQ463 / PRO791 |
Antigen Seq |
GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSS |
Bioactivity |
Measured by its binding ability in a functional ELISA. Immobilized Human ULBP2 at 2μg/mL (100 μL/well) can bind NKG2D with a linear range of 0. 122-22. 17ng/mL. |
Protein Formulation |
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation. |
Expected Protein Size |
22.57 kDa |
Gene Symbol |
NKG2D ligand 2/ULBP2 |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.