« Back
Home /
Recombinant Human Fc-gamma RIII beta/FCGR3B/CD16b (S36R, N82D, I106V) Protein

Recombinant Human Fc-gamma RIII beta/FCGR3B/CD16b (S36R, N82D, I106V) Protein

Item no.	RP00474-50ug
Manufacturer	Abclonal
Amount	50 ug
Quantity options	1000 ug 100 ug 10 ug 500 ug 50 ug
Category	Neuroscience Neural Lineage Markers Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins Obesity
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE;> 95% by HPLC
Sequence	GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
NCBI	Fc gamma RIIIB/CD16b (NA1)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD16,Fc gamma RIIIB,FCG3,FCGR3B,FcgRIIIB,FCRIIIB,IGFR3,CD16b (NA2),CD16B,FCG3B,FCG3,FCGR3,FCR-10
Similar products	IL11, IL-11, AGIF, Interleukin-11, Oprelvekin, Adipogenesis Inhibitory Factor
Available
Manufacturer - Applications	< 1 EU/μg of the protein by LAL method
Manufacturer - Category	Proteins
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	22.52 kDa
Description	Recombinant Human Fc-gamma RIII beta/FCGR3B/CD16b (S36R, N82D, I106V) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly17-Ser200) of Human Fc-gamma RIII beta/FCGR3B/CD16b (S36R, N82D, I106V) (Accession #O75015) fused with a C-His tag at the C-terminus.
Background	Human Fc gamma RIIIB/CD16b Protein is a receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Gly17-Ser200(NA1)
Route	C-His
Endotoxin	< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Biosimilar Drug Targets, Bio-Markers & CD Antigens
Antigen Seq	GMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTIS
Protein Formulation	Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Expected Protein Size	22.52 kDa
Gene Symbol	Fc gamma RIIIB/CD16b (NA1)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP00474-50ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 8/28/2025

Compare

Add to wishlist

Get an offer

Request delivery time