Comparison

Recombinant Mouse FGF-1/aFGF Protein European Partner

Item no. RP00487-1000ug
Manufacturer Abclonal
Amount 1000 ug
Quantity options 1000 ug 100 ug 10 ug 20 ug 500 ug 50 ug
Category
Type Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Host Mouse
Purity > 95% by SDS-PAGE.
NCBI FGF-1/aFGF
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Fibroblast Growth Factor 1,FGF-1,Acidic Fibroblast Growth Factor,aFGF,Heparin-BindingGrowth Factor 1,HBGF-1,Fgf1,Fgf-1,Fgfa
Similar products Acidic Fibroblast Growth Factor, Fgf1, aFGF, Fibroblast Growth Factor 1, FGF-1, Fgfa, Fgf-1, HBGF-1, Heparin-BindingGrowth Factor 1
Shipping Condition Cool pack
Available
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
15.79 kDa
Description
Recombinant Mouse FGF-1/aFGF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Phe16-Asp155) of mouse FGF1/FGFa/FGF acidic (Accession #P61148).
Background
FGF acidic is a 17 kDa nonglycosylated member of the FGF family of mitogenic peptides. FGF acidic, which isproduced by multiple cell types, stimulates the proliferation of all cells of mesodermal origin and many cells ofneuroectodermal, ectodermal, and endodermal origin. It plays a number of roles in development, regeneration, and angiogenesis. FGF-acidic is a non-glycosylated heparin binding growth factor that isexpressed in the brain, kidney, retina, smooth muscle cells, bone matrix, osteoblasts, astrocytes andendothelial cells. FGF-acidic has the ability to signal through all the FGF receptors.
Manufacturer - Cross Reactivity
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Phe16-Asp155
Route
No tag
Manufacturer - Research Area
Growth Factor
Revised name
Fibroblast Growth Factor 1, FGF-1, Acidic Fibroblast Growth Factor, aFGF, Heparin-BindingGrowth Factor 1, HBGF-1, Fgf1, Fgf-1, Fgfa
Antigen Seq
FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, pH7.5, 50 mM Na2SO4, 0.5 mM DTT, 1 mM EDTA. Contact us for customized product form or formulation.
Expected Protein Size
15.79 kDa
Gene Symbol
FGF-1/aFGF

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1000 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close