Comparison

Recombinant Human FABP3/H-FABP Protein European Partner

Item no. RP00502-10ug
Manufacturer Abclonal
Amount 10 ug
Quantity options 1000 ug 100 ug 10 ug 20 ug 500 ug 50 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 98% by SDS-PAGE.
Sequence VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
NCBI FABP3
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias FABP3,FABP11,MDGI,Fatty acid-binding protein,heart,Fatty acid-binding protein 3,Heart-type fatty acid-binding protein,H-FABP,Mammary-derived growth inhibitor,MDGI,Muscle fatty acid-binding protein,M-FABP
Similar products FABP3, FABP11, MDGI, H-FABP, M-FABP, Fatty Acid-Binding Protein Heart, Fatty Acid-Binding Protein 3, Mammary-Derived Growth Inhibitor, MDGIMuscle Fatty Acid-Binding Protein, Heart-Type Fatty Acid-BindingProtein
Shipping Condition Cool pack
Available
Manufacturer - Applications
< 0.01EU/μg of the protein by LAL method
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
15.57 kDa
Manufacturer - Additional Information
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Recombinant Human FABP3/H-FABP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val2-Ala133) of Human FABP3/H-FABP (Accession #NP_004093.1) fused with a His tag at the N-terminus.
Background
FABP3/H-FABP, FABPs are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.Fatty acid binding protein-3 is a member of a large superfamily of lipid binding proteins that are expressed in a tissue specific manner . Although all are highly conserved in their tertiary structure, there is only modest aa identity between any two members. The FABP family members are subdivided based on organ or tissue type it was originally expressed or identified; liver- (L-FABP), intestine- (I-FABP), heart- (H-FABP), adipocyte- (A-FABP), epidermal- (E-FABP), ileal- (IL-FABP), brain- (B-FABP), myelin- (M-FABP) and testis-FABP (T-FABP). Human H-FABP, the product of the FABP3 gene, is a 132 aa cytosolic protein that shows a flattened beta -barrel structure generated by a series of antiparallel beta ‑strands and two alpha ‑helices . One molecule of FABP3 is capable of binding one long-chain fatty acid . It is suggested that ligands first bind to the outside of the molecule, and this binding subsequently induces a conformational change in the binding protein, resulting in "internalization" of the ligand . Human FABP3 is 86%, 89% and 89% aa identical to mouse, rat and canine FABP3, respectively.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Val2-Ala133
Route
N-His
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Other Recombinant Protein
Antigen Seq
VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
Protein Formulation
Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Expected Protein Size
15.57 kDa
Gene Symbol
FABP3

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close