Comparison

Recombinant Human TNF beta/TNFb/TNFSF1B Protein European Partner

Item no. RP00506-500ug
Manufacturer Abclonal
Amount 500 ug
Quantity options 1000 ug 10 ug 500 ug 50 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE.
Sequence LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
NCBI TNF-beta/LT-alpha
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Lymphotoxin-Alpha,LT-Alpha,TNF-Beta,Tumor Necrosis Factor Ligand Superfamily Member 1,LTA,TNFB,TNFSF1
Similar products LTA, TNFB, TNFSF1, Tumor Necrosis Factor Ligand Superfamily Member 1, Lymphotoxin-Alpha, LT-Alpha, TNF-Beta
Available
Manufacturer - Category
Proteins
Storage Conditions
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Description
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background
Tumor Necrosis Factor β (TNF- β ) is a secreted protein belonging to the tumor necrosis factor family. TNF- βbinds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM in homotrimeric form, binds toTNFRSF3/LTBR in heterotrimeric form with LTB. TNF- β forms heterotrimers with lymphotoxin-beta, whichanchors TNF- β to the cell surface. TNF- β mediates the inflammatory, immunostimulatory, and antiviralresponse, involves in the formation of second lymphoid organs during development, has a role in apoptosis.TNF-β is produced by lymphocytes and cytotoxic for a variety of tumor cells in vitro and in vivo.
Immunogen
Leu35-Leu205
Route
No tag
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
TNF family, Biosimilar Drug Targets
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.Contact us for customized product form or formulation.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close