Recombinant Human IL-20RA Protein

Proteins

Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.

Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.

Interleukin-20 Receptor Subunit α (IL20RA) is a single-pass type I membrane protein that is a member of thetype II cytokine receptor family. IL20RA is synthetized a 553 amino acid glycoprotein precursor containing a 29amino acid signal peptide, a 221 amino acid extracellular domain with two fibronectin type-III domains, a 24amino acid transmembrane region, and a 279 amino acid intracellular domain. IL20RA is widely expressed withhighest levels found in skin and testis and high levels in brain. IL20RA forms a heterodimer with IL20RB, andthe complex serves as a receptor for IL19, IL20 and IL24. IL20RA also forms a heterodimer with the unique andspecific receptor IL10RB and functions as the receptor for IL26.

Val30-Lys250

< 1 EU/μg of the protein by LAL method.

VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAK

42.3 kDa