Comparison

Recombinant Human BST-1/CD157 Protein European Partner

Item no. RP00541-10ug
Manufacturer Abclonal
Amount 10 ug
Quantity options 1000 ug 100 ug 10 ug 20 ug 500 ug 50 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 97% by SDS-PAGE.
Sequence GARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALK
NCBI BST-1/CD157
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias BST1,CD157
Similar products CD157, BST-1, cADPr hydrolase 2, ADP-ribosyl cyclase 2, Cyclic ADP-ribose hydrolase 2, ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2, Bone marrow stromalantigen 1
Shipping Condition Cool pack
Available
Manufacturer - Applications
< 0.01 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
29.95 kDa
Manufacturer - Additional Information
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Human BST-1/CD157 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Gly29-Lys292) of human CD157/BST1/ADP-ribosyl cyclase 2/Cyclic ADP-ribose hydrolase 2 (Accession #Q10588) fused with a 6×His tag at the C-terminus.
Background
The cluster of differentiation (CD) system is a glycosyl phosphatidylinositol anchored membrane protein thatbelongs to the CD38 family.It is generally used in immunophynotyping. CD157 was discovered in a bonemarrow stromal cell line where it facilitates pre-B-cell growth. CD157 is a bifunctional ectoenzyme that exhibitsboth ADP-ribosyl cyclase and cyclic ADP ribose hydrolase activities followed with CD38. It plays a role inrheumatoid arthritis (RA) due to its enhanced expression in RA-derived bone marrow stromal cell lines. Studieshave shown that this protein have a role in predicted to function as a cell surface receptor and animmunoregulatory molecule.
Manufacturer - Cross Reactivity
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Gly29-Lys292
Route
C-His
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Bio-Markers & CD Antigens
Antigen Seq
GARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALK
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
Expected Protein Size
29.95 kDa
Gene Symbol
BST-1/CD157

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close