Comparison

Recombinant Human TNFRSF8/CD30 Protein European Partner

Item no. RP00557-50ug
Manufacturer Abclonal
Amount 50 ug
Quantity options 100 ug 10 ug 50 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Purity > 95% by SDS-PAGE;> 95% by HPLC
Sequence MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSW
NCBI CD30/TNFRSF8
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias CD30,CD30KI-1,CD30L receptor,TNFRSF8,D1S166EKi-1,CD30KI-1
Available
Manufacturer - Applications
< 1 EU/μg of the protein by LAL method
Manufacturer - Category
Proteins
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
41.3 kDa
Description
Recombinant Human TNFRSF8/CD30 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe19-Lys379) of Human TNFRSF8/CD30 (Accession #P28908-1) fused with a C-His&Avi tag at the C-terminus.
Background
The transmembrane receptor CD30 (TNFRSF8) and its ligand CD30L (CD153, TNFSF8) are members of the tumor necrosis factor (TNF) superfamily and display restricted expression in subpopulations of activated T-and B-cells in nonpathologic conditions. CD30 expression is upregulated in various hematological malignancies, including Reed-Sternberg cells in Hodgkin's disease (HD), anaplastic large cell lymphoma (ALCL) and subsets of Non-Hodgkin's lymphomas (NHLs).
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Phe19-Lys379
Recommended Dilution
Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Route
C-His&Avi
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Biosimilar Drug Targets, Bio-Markers & CD Antigens
Antigen Seq
FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK
Protein Formulation
Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Expected Protein Size
41.3 kDa
Gene Symbol
CD30/TNFRSF8

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Delivery expected until 11/27/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close