Comparison

Recombinant Mouse CSF-3/G-CSF Protein European Partner

Item no. RP00573-500ug
Manufacturer Abclonal
Amount 500 ug
Quantity options 1000 ug 100 ug 10 ug 20 ug 500 ug 50 ug
Category
Type Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Purity > 95% by SDS-PAGE.
NCBI G-CSF/CSF3
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Granulocyte colony-stimulating factor,Csf3,G-CSF
Shipping condition Cool pack
Available
Manufacturer - Applications
< 1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
19.79 kDa
Description
Recombinant Mouse CSF-3/G-CSF Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Met1-Ala208) of mouse G-CSF/CSF3 (Accession #P09920) fused with a 6×His tag at the C-terminus.
Background
Granulocyte colony-stimulating factor (G-CSF) is a growth factor and an essential cytokine which belongs to theIL-6 superfamily. Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesisby controlling the production, differentiation, and function of 2 related white cell populations of the blood, thegranulocytes and the monocytes-macrophages. G-CSF binding to its receptor G-CSF-R which belongs to thecytokine receptor type I family depends on the interaction of alpha-helical motifs of the former and twofibronectin type III as well as an immunoglobulin-like domain of the latter. G-CSF is a cytokine that have beendemonstrated to improve cardiac function and perfusion in myocardial infarction. And it was initially evaluatedas a stem cell mobilizer and erythropoietin as a cytoprotective agent.
Manufacturer - Cross Reactivity
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Met1-Ala208
Recommended Dilution
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
Route
C-His
Manufacturer - Research Area
Cytokines & Cytokine Receptors
Antigen Seq
VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA
Bioactivity
Measured in a cell proliferation assay using NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 38. 7-154. 8 pg/mL, corresponding to a specific activity of 6. 46×106-2. 58×107 units/mg.
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
Expected Protein Size
19.79 kDa
Gene Symbol
G-CSF/CSF3

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close