Item no. |
RP00573-500ug |
Manufacturer |
Abclonal
|
Amount |
500 ug |
Quantity options |
1000 ug
100 ug
10 ug
20 ug
500 ug
50 ug
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
Mouse (Murine, Mus musculus) |
Purity |
> 95% by SDS-PAGE. |
NCBI |
G-CSF/CSF3 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Granulocyte colony-stimulating factor,Csf3,G-CSF |
Shipping condition |
Cool pack |
Available |
|
Manufacturer - Applications |
< 1 EU/μg of the protein by LAL method. |
Manufacturer - Category |
Proteins |
Shipping Temperature |
ice pack |
Storage Conditions |
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week. |
Protein Weight |
19.79 kDa |
Description |
Recombinant Mouse CSF-3/G-CSF Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Met1-Ala208) of mouse G-CSF/CSF3 (Accession #P09920) fused with a 6×His tag at the C-terminus. |
Background |
Granulocyte colony-stimulating factor (G-CSF) is a growth factor and an essential cytokine which belongs to theIL-6 superfamily. Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesisby controlling the production, differentiation, and function of 2 related white cell populations of the blood, thegranulocytes and the monocytes-macrophages. G-CSF binding to its receptor G-CSF-R which belongs to thecytokine receptor type I family depends on the interaction of alpha-helical motifs of the former and twofibronectin type III as well as an immunoglobulin-like domain of the latter. G-CSF is a cytokine that have beendemonstrated to improve cardiac function and perfusion in myocardial infarction. And it was initially evaluatedas a stem cell mobilizer and erythropoietin as a cytoprotective agent. |
Manufacturer - Cross Reactivity |
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles. |
Immunogen |
Met1-Ala208 |
Recommended Dilution |
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation. |
Route |
C-His |
Manufacturer - Research Area |
Cytokines & Cytokine Receptors |
Antigen Seq |
VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA |
Bioactivity |
Measured in a cell proliferation assay using NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 38. 7-154. 8 pg/mL, corresponding to a specific activity of 6. 46×106-2. 58×107 units/mg. |
Protein Formulation |
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation. |
Expected Protein Size |
19.79 kDa |
Gene Symbol |
G-CSF/CSF3 |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.