Comparison

Recombinant Human CD3 epsilon Protein European Partner

Item no. RP00601-10ug
Manufacturer Abclonal
Amount 10 ug
Quantity options 100 ug 10 ug 50 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Purity > 95% by SDS-PAGE
Sequence NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP
NCBI CD3E
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias CD3e,CD3E,T3E,FLJ18683,TCRE,CD3-epsilon,IMD18
Available
Manufacturer - Applications
< 1 EU/μg of the protein by LAL method
Manufacturer - Category
Proteins
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
36.1 kDa
Description
Recombinant Human CD3 epsilon Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp23-Asp126) of Human CD3 epsilon (Accession #P07766) fused with a C-hFc tag at the C-terminus.
Background
T-cell surface glycoprotein CD3 epsilon & CD3 gamma chain, also known as CD3E & CD3G , are single-pass type I membrane proteins.When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Asp23-Asp126(C119S, C122S)
Route
C-hFc
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Biosimilar Drug Targets, Bio-Markers & CD Antigens
Antigen Seq
DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVSENSMEMD
Bioactivity
Measured by its binding ability in a functional ELISA. When Recombinant Human CD28/TP44 Fc Chimera is coated at 1 μg/mL (100 μL/well), the concentration of Recombinant Human B7-1/CD80 that produces 50% of the optimal binding response is approximately 0. 05-0. 3 μg/mL.
Protein Formulation
Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Expected Protein Size
36.1 kDa
Gene Symbol
CD3E

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close