Comparison

Recombinant Rat SCF/Stem Cell Factor Protein European Partner

Item no. RP00613-1000ug
Manufacturer Abclonal
Amount 1000 ug
Quantity options 1000 ug 10 ug 500 ug 50 ug
Category
Type Proteins Recombinant
Specific against Rat (Rattus norvegicus)
Purity > 95% by SDS-PAGE.
Sequence QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
NCBI SCF/Stem Cell Factor
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Kit ligand,Hematopoietic growth factor KL,Mast cell growth factor,MGF,Steel factor,Stem cellfactor,SCF
Shipping condition Cool pack
Available
Manufacturer - Category
Cytokines & Cytokine Receptors
Shipping Temperature
ice pack
Storage Conditions
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Availability
Inquiry before order
Manufacturer - Additional Information
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Rat SCF/Stem Cell Factor Protein is produced by E. coli expression system. The target protein is expressed with sequence (Gln26-Ala189) of rat SCF/Stem Cell Factor (Accession #P21581) fused with an initial Met at the N-terminus and a 6xHis tag at the C-terminus.
Background
Stem cell factor (SCF), is the ligand for the receptor-type protein-tyrosine kinase KIT. It plays an essential role inthe regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mastcell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate severalsignaling pathways. It also promotes phosphorylation of PIK3R1, which is the regulatory subunit ofphosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmitsignals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1.KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5.
Immunogen
Gln26-Ala189
Route
C-6xHis
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Cytokines & Cytokine Receptors
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1000 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close