Comparison

Recombinant Mouse TNFRSF4/OX40 Protein European Partner

Item no. RP00676-50ug
Manufacturer Abclonal
Amount 50 ug
Quantity options 1000 ug 10 ug 500 ug 50 ug
Category
Type Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Host Mouse
Purity > 95% by SDS-PAGE.
Sequence VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP
NCBI TNFRSF4/OX40/CD134
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Tumor necrosis factor receptor superfamily member 4,Tnfrsf4,OX40,CD134,Txgp1
Similar products Tnfrsf4, CD134, OX40, Tumor necrosis factor receptor superfamily member 4, Txgp1
Available
Manufacturer - Category
Proteins
Storage Conditions
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Description
Reconstitute to a concentration of 0.1-0.5 mg/mL in 1X PBS.
Background
OX40, also termed CD134 and TNFRSF4, is a T cell co-stimulatory molecule of the TNF receptor superfamilywhich plays a key role in the survival and homeostasis of effector and memory T cells. OX40 is expressed onCD4+ and CD8+ T cells upon engagement of the TCR by antigen presenting cells along with co-stimulation byCD40-CD40 Ligand and CD28-B7. The interaction between OX40 and OX40 ligand (OX40L) will occur whenactivated T cells bind to professional antigen-presenting cells (APCs). The T-cell functions, including cytokineproduction, expansion, and survival, are then enhanced by the OX40 costimulatory signals. OX40 signals arecritical for controlling the function and differentiation of Foxp3+ regulatory T cells. OX40-OX40L interactionregulates T-cell tolerance, peripheral T-cell homeostasis, and T-cell-mediated inflammatory diseases.
Immunogen
Val20-Pro211
Route
C-Fc
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Immune Checkpoint, TNF family
Protein Formulation
Lyophilized from a 0.2 μM filtered solution of PBS, pH 7.4Contact us for customized product form or formulation.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close