Recombinant Mouse TNFSF4/OX40 ligand/CD252 Protein

Proteins

Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.

Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.

OX40 ligand (OX40L), also called CD252, is a single-pass type II membrane protein of the TNF/TNF receptorsuperfamily. OX40L is expressed by DCs, macrophages and B cells and signals via its cognate receptor OX40which is mainly expressed on APCs. OX40L/OX40 interactions are important in T-cell activation and survival andfor the generation of memory T cells from activated effector T cells. OX40L – OX40 co-stimulation leads toactivation of TNF receptor associated factor (TRAF) 2, 3 and 5. This pathway has been shown to prolong thesurvival of effector CD4+Th cells as well as contributes to generation of memory T cells.

Ser51-Leu198

< 1 EU/μg of the protein by LAL method.

SSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL

17.7 kDa