Comparison

Recombinant Mouse IL-1 R2/IL-1 RII Protein European Partner

Item no. RP00726-10ug
Manufacturer Abclonal
Amount 10 ug
Quantity options 1000 ug 10 ug 500 ug 50 ug
Category
Type Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Purity > 95% by SDS-PAGE.
Sequence FTTPTVVHTGKVSESPITSEKPTVHGDNCQFRGREFKSELRLEGEPVVLRCPLAPHSDISSSSHSFLTWSKLDSSQLIPRDEPRMWVKGNILWILPAVQQDSGTYICTFRNASHCEQMSVELKVFKNTEASLPHVSYLQISALSTTGLLVCPDLKEFISSNADGKIQWYKGAILLDKGNKEFLSAGDPTRLLISNTSMDDAGYYRCVMTFTYNGQEYNITRNIELRVKGTTTEPIPVIISPLETIPASLGSRLIV
NCBI IL-1 RII
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Interleukin-1 receptor type 2,IL-1R-2,IL-1RT-2,IL-1RT2,CD121 antigen-like family member B,CD121b,IL-1 type II receptor,Interleukin-1 receptor beta,IL-1R-beta,Interleukin-1 receptor typeII,CD121b
Shipping Condition Cool pack
Available
Manufacturer - Category
Cytokines & Cytokine Receptors
Shipping Temperature
ice pack
Storage Conditions
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturer - Additional Information
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Description
Recombinant Mouse IL-1 R2/IL-1 RII Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Phe14-Glu355) of mouse IL-1 R2/IL-1 RII (Accession #P27931) fused with a 6xHis tag at the C-terminus.
Background
Mouse Interleukin 1 receptor, type II (IL1R2) is a cytokine receptor that belongs to the interleukin-1 receptorfamily. This protein binds interleukin alpha (IL1A), interleukin beta (IL1B), and interleukin 1 receptor, type I(IL1R1/IL1RA), and acts as a decoy receptor that inhibits the activity of its ligands. IL-1R2 structurally consistingof a ligand binding portion comprised of three Ig-like domains, a single transmembrane region, and a shortcytoplasmic domain. It is expressed in a variety of cell types including B lymphocytes, neutrophils, monocytes, large granular leukocytes and endothelial cells. Mouse IL1RII shares 59% amino acid sequence homology withhuman IL1 RII in their extracellular domains. The pleiotropic cytokine IL1 is produced to regulate developmentand maintenance of the inflammatory responses, and binds to specific plasma membrane receptors on cells.Two distinct types of IL1 receptors which are able to bind IL1 specifically have been identified, designated asIL1RI (IL1RA) and IL1RII (IL1RB). IL1R1 contributes to IL-1 signaling, whereas the IL-1R2 has no signalingproperty and acts as a decoy for IL-1.
Manufacturer - Cross Reactivity
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Immunogen
Phe14-Glu355
Route
C-6xHis
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Cytokines & Cytokine Receptors
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close