Item no. |
RP00726-10ug |
Manufacturer |
Abclonal
|
Amount |
10 ug |
Quantity options |
1000 ug
10 ug
500 ug
50 ug
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
Mouse (Murine, Mus musculus) |
Purity |
> 95% by SDS-PAGE. |
Sequence |
FTTPTVVHTGKVSESPITSEKPTVHGDNCQFRGREFKSELRLEGEPVVLRCPLAPHSDISSSSHSFLTWSKLDSSQLIPRDEPRMWVKGNILWILPAVQQDSGTYICTFRNASHCEQMSVELKVFKNTEASLPHVSYLQISALSTTGLLVCPDLKEFISSNADGKIQWYKGAILLDKGNKEFLSAGDPTRLLISNTSMDDAGYYRCVMTFTYNGQEYNITRNIELRVKGTTTEPIPVIISPLETIPASLGSRLIV |
NCBI |
IL-1 RII |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Interleukin-1 receptor type 2,IL-1R-2,IL-1RT-2,IL-1RT2,CD121 antigen-like family member B,CD121b,IL-1 type II receptor,Interleukin-1 receptor beta,IL-1R-beta,Interleukin-1 receptor typeII,CD121b |
Shipping condition |
Cool pack |
Available |
|
Manufacturer - Category |
Cytokines & Cytokine Receptors |
Shipping Temperature |
ice pack |
Storage Conditions |
Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week. |
Manufacturer - Additional Information |
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. |
Description |
Recombinant Mouse IL-1 R2/IL-1 RII Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Phe14-Glu355) of mouse IL-1 R2/IL-1 RII (Accession #P27931) fused with a 6xHis tag at the C-terminus. |
Background |
Mouse Interleukin 1 receptor, type II (IL1R2) is a cytokine receptor that belongs to the interleukin-1 receptorfamily. This protein binds interleukin alpha (IL1A), interleukin beta (IL1B), and interleukin 1 receptor, type I(IL1R1/IL1RA), and acts as a decoy receptor that inhibits the activity of its ligands. IL-1R2 structurally consistingof a ligand binding portion comprised of three Ig-like domains, a single transmembrane region, and a shortcytoplasmic domain. It is expressed in a variety of cell types including B lymphocytes, neutrophils, monocytes, large granular leukocytes and endothelial cells. Mouse IL1RII shares 59% amino acid sequence homology withhuman IL1 RII in their extracellular domains. The pleiotropic cytokine IL1 is produced to regulate developmentand maintenance of the inflammatory responses, and binds to specific plasma membrane receptors on cells.Two distinct types of IL1 receptors which are able to bind IL1 specifically have been identified, designated asIL1RI (IL1RA) and IL1RII (IL1RB). IL1R1 contributes to IL-1 signaling, whereas the IL-1R2 has no signalingproperty and acts as a decoy for IL-1. |
Manufacturer - Cross Reactivity |
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. |
Immunogen |
Phe14-Glu355 |
Route |
C-6xHis |
Endotoxin |
< 1 EU/μg of the protein by LAL method. |
Manufacturer - Research Area |
Cytokines & Cytokine Receptors |
Protein Formulation |
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation. |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.