Comparison

Recombinant Mouse IL-1 R1/IL-1 RI Protein European Partner

Item no. RP00728-500ug
Manufacturer Abclonal
Amount 500 ug
Quantity options 1000 ug 10 ug 500 ug 50 ug
Category
Type Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Purity > 95% by SDS-PAGE.
NCBI IL-1 RI
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Interleukin-1 receptor type 1,IL-1R-1,IL-1RT-1,IL-1RT1,CD121 antigen-like family member A,Interleukin-1 receptor alpha,IL-1R-alpha,p80,CD121a,mIL-1R1
Shipping condition Cool pack
Available
Manufacturer - Category
Cytokines & Cytokine Receptors
Shipping Temperature
ice pack
Storage Conditions
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Description
Recombinant Mouse IL-1 R1/IL-1 RI Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Leu20-Lys338) of mouse IL-1 R1/IL-1 RI (Accession #P13504) fused with an Fc tag at the C-terminus.
Background
Mouse Interleukin-1 receptor type 1/IL-1 RI is a cytokine receptor that belongs to the interleukin-1 receptorfamily. This protein is a receptor for interleukin 1 alpha (IL1A), interleukin 1 beta (IL1B), and interleukin 1receptor antagonist (IL1RA). It is an important mediator involved in many cytokine induced immune andinflammatory responses. An IL1 receptor accessory protein that can heterodimerize with the Type I receptor inthe presence of IL1α or IL1β but not IL1ra, was identified. This Type I receptor complex appears to mediate allthe known IL1 biological responses. The receptor Type II has a short cytoplasmic domain and does nottransduce IL1 signals. In addition to the membranebound form of IL1 RII, a naturallyoccurring soluble form ofIL1 RII has been described. It has been suggested that the Type II receptor, either as the membranebound or asthe soluble form, serves as a decoy for IL1 and inhibits IL1 action by blocking the binding of IL1 to the signalingType I receptor complex.
Manufacturer - Cross Reactivity
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Immunogen
Leu20-Lys338
Recommended Dilution
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
Route
C-Fc
Antigen Seq
LEIDVCTEYPNQIVLFLSVNEIDIRKCPLTPNKMHGDTIIWYKNDSKTPISADRDSRIHQQNEHLWFVPAKVEDSGYYYCIVRNSTYCLKTKVTVTVLENDPGLCYSTQATFPQRLHIAGDGSLVCPYVSYFKDENNELPEVQWYKNCKPLLLDNVSFFGVKDKLLVRNVAEEHRGDYICRMSYTFRGKQYPVTRVIQFITIDENKRDRPVILSPRNETIEADPGSMIQLICNVTGQFSDLVYWKWNGSEIEWND
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close