Comparison

Recombinant Mouse TNFSF11/RANKL/CD254 Protein European Partner

Item no. RP00745-20ug
Manufacturer Abclonal
Amount 20 ug
Quantity options 1000 ug 100 ug 10 ug 20 ug 500 ug 50 ug
Category
Type Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Purity > 95% by SDS-PAGE.
Sequence QRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
NCBI TNFSF11/RANKL/CD254
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Tumor necrosis factor ligand superfamily member 11,Tnfsf11,Osteoclast differentiationfactor,ODF,Osteoprotegerin ligand,OPGL,Receptor activator of nuclear factor kappa-Bligand,RANKL,TNF-related activation-induced cytokine,TRANCE,CD254,TNFSF11
Shipping Condition Cool pack
Available
Manufacturer - Category
TNF family
Shipping Temperature
ice pack
Storage Conditions
Store the lyophilized protein at -20°C to -80°C for 12 months.|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Manufacturer - Additional Information
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Mouse TNFSF11/RANK L/TRANCE Protein is produced by E. coli expression system. The target protein is expressed with sequence (Arg156-Asp316) of mouse TNFSF11/RANK L/TRANCE (Accession #O35235).
Background
Mouse tumor necrosis factor ligand superfamily member 11(Tnfsf11) is a member of the tumor necrosis factor(TNF) cytokine family. Tnfsf11 is widely expressed in cells including T cells and T cell rich organs, such asthymus and lymph nodes. This cytokine can bind to TNFRSF11B/OPG andTNFRSF11A/RANK. Tnfsf11 is involvedin a number of fundamental biological processes such as acting as regulator of interactions between T-cells anddendritic cells, the regulation of the T-cell-dependent immune response and enhancing bone-resorption inhumoral hypercalcemia of malignancy. It augments the ability of dendritic cells to stimulate naive T-cellproliferation.
Immunogen
Gln137-Asp316
Route
No tag
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
TNF family
Bioactivity
Measured by its ability to induce osteoclast differentiation of RAW 264. 7 mouse monocyte/macrophage cells. The ED50 for this effect is 2. 30-9. 22 ng/mL, corresponding to a specific activity of 1. 08x105~4. 35x105 units/mg.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close