Recombinant Mouse CD47 Protein

Proteins

Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.

Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.

CD47, also known as Integrin‑Associated Protein (IAP) and OA3, is a glycosylated atypical member of theimmunoglobulin superfamily. Mouse CD47 is an integral membrane protein that consists of a extracellulardomain (ECD) with a single Ig‑like domain, five membrane-spanning regions with short intervening loops, andC‑terminal cytoplasmic tail. CD47 has a role in both cell adhesion by acting as an adhesion receptor for THBS1on platelets, and in the modulation of integrins. It plays an important role in memory formation and synapticplasticity in the hippocampus. As a receptor for SIRPA, it binding to which prevents maturation of immaturedendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediatescellcell adhesion, it enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cellactivation. It may play a role in membrane transport and/or integrin dependent signal transduction. It alsoprevents premature elimination of red blood cells.

Gln19-Lys140

<0.1 EU/μg

QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEK

14.68 kDa