Item no. |
RP00777-50ug |
Manufacturer |
Abclonal
|
Amount |
50 ug |
Quantity options |
1000 ug
10 ug
500 ug
50 ug
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
Mouse (Murine, Mus musculus) |
Purity |
> 95% by SDS-PAGE. |
Sequence |
SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKFPNRTSGLLETNFSVTARTAGPGLLSRLQGFRVKITPGQLNQTSRSPVQISGYLNRTHGPVNGTHGLFAGTSLQTLEASDIS |
NCBI |
TPO/Thrombopoietin/THPO |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Thrombopoietin,C-mpl ligand,Megakaryocyte colony-stimulating factor,Megakaryocyte growthand development factor,Myeloproliferative leukemia virus oncogene ligand,THPO |
Available |
|
Manufacturer - Category |
Proteins |
Storage Conditions |
Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week. |
Description |
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. |
Background |
Thrombopoietin (TPO) is a glycoprotein hormone which belongs to the EPO/TPO family. It produced by theliver and kidney which regulates the production of platelets.Mature mouse Tpo shares 71% and 81% aasequence homology with human and rat Tpo, respectively. It is an 80-85 kDa protein that consists of an N-terminal domain with homology to Erythropoietin (Epo) and a C-terminal domain that contains multiple N-linked and O-linked glycosylation sites. TPO stimulates the production and differentiation of megakaryocytes, the bone marrow cells that bud off large numbers of platelets. Lineage-specific cytokine affects theproliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage ofmegakaryocyte development. It may be the major physiological regulator of circulating platelets. |
Immunogen |
Ser22-Thr356 |
Route |
C-6xHis |
Endotoxin |
< 1 EU/μg of the protein by LAL method. |
Manufacturer - Research Area |
Cytokines & Cytokine Receptors |
Protein Formulation |
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation. |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.