Comparison

Recombinant Mouse TPO/Thrombopoietin/THPO Protein European Partner

Item no. RP00777-50ug
Manufacturer Abclonal
Amount 50 ug
Quantity options 1000 ug 10 ug 500 ug 50 ug
Category
Type Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Purity > 95% by SDS-PAGE.
Sequence SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKFPNRTSGLLETNFSVTARTAGPGLLSRLQGFRVKITPGQLNQTSRSPVQISGYLNRTHGPVNGTHGLFAGTSLQTLEASDIS
NCBI TPO/Thrombopoietin/THPO
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Thrombopoietin,C-mpl ligand,Megakaryocyte colony-stimulating factor,Megakaryocyte growthand development factor,Myeloproliferative leukemia virus oncogene ligand,THPO
Available
Manufacturer - Category
Proteins
Storage Conditions
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Description
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background
Thrombopoietin (TPO) is a glycoprotein hormone which belongs to the EPO/TPO family. It produced by theliver and kidney which regulates the production of platelets.Mature mouse Tpo shares 71% and 81% aasequence homology with human and rat Tpo, respectively. It is an 80-85 kDa protein that consists of an N-terminal domain with homology to Erythropoietin (Epo) and a C-terminal domain that contains multiple N-linked and O-linked glycosylation sites. TPO stimulates the production and differentiation of megakaryocytes, the bone marrow cells that bud off large numbers of platelets. Lineage-specific cytokine affects theproliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage ofmegakaryocyte development. It may be the major physiological regulator of circulating platelets.
Immunogen
Ser22-Thr356
Route
C-6xHis
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Cytokines & Cytokine Receptors
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close