« Back
Home /
Recombinant Human CXCL7/NAP-2 Protein

Recombinant Human CXCL7/NAP-2 Protein

Item no.	RP00829-50ug
Manufacturer	Abclonal
Amount	50 ug
Quantity options	1000 ug 10 ug 500 ug 50 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
Sequence	AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
NCBI	CXCL7/LDGF/MDGF
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Platelet Basic Protein,PBP,C-X-C Motif Chemokine 7,Leukocyte-Derived Growth Factor,LDGF,Macrophage-Derived Growth Factor,MDGFSmall-Inducible Cytokine B7,PPBP,CTAP3,CXCL7,SCYB7,TGB1,THBGB1
Similar products	PPBP, PBP, CTAP3, CXCL7, LDGF, SCYB7, TGB1, THBGB1, Platelet Basic Protein, C-X-C Motif Chemokine 7, Leukocyte-Derived Growth Factor, Macrophage-Derived Growth Factor, MDGFSmall-Inducible Cytokine B7
Available
Manufacturer - Category	Proteins
Storage Conditions	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Immunogen	Ala59-Asp128
Route	No tag
Endotoxin	< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Cytokines & Cytokine receptors
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.Contact us for customized product form or formulation.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP00829-50ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer