« Back
Home /
Recombinant Human IL-17F Protein

Recombinant Human IL-17F Protein

Item no.	RP00870-50ug
Manufacturer	Abclonal
Amount	50 ug
Quantity options	100 ug 10 ug 20 ug 50 ug
Category	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Purity	> 95% by SDS-PAGE.
Sequence	RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ
NCBI	IL-17F
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	IL17F,CANDF6,IL-17F,ML-1,ML1
Shipping Condition	Cool pack
Available
Manufacturer - Applications	< 0.01 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	15.76 kDa
Manufacturer - Additional Information	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Description	Recombinant Human IL-17F Protein is produced by Human cells expression system. The target protein is expressed with sequence (Arg31-Gln163) of human IL-17F (Accession #Q96PD4) fused with a His tag at the N-terminus.
Manufacturer - Cross Reactivity	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Immunogen	Arg31-Gln163
Route	N-His
Endotoxin	< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Cytokines & Cytokine Receptors
Antigen Seq	RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ
Bioactivity	Measured by its ability to induce IL-6 secretion by NIH‑3T3 mouse embryonic fibroblast cells in the presense of 2 ng/mL TNFα(Catalog: RP01071). The ED₅₀ for this effect is 3. 51-14. 04 ng/mL, corresponding to a specific activity of 7. 12×10^4<
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.Contact us for customized product form or formulation.
Expected Protein Size	15.76 kDa
Gene Symbol	IL-17F

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP00870-50ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 12/25/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer