« Back
Home /
Recombinant Human TNFSF18/AITRL Protein

Recombinant Human TNFSF18/AITRL Protein

Item no.	RP00912-50ug
Manufacturer	Abclonal
Amount	50 ug
Quantity options	1000 ug 10 ug 500 ug 50 ug
Category	Oncology Neuroscience Neuroinflammation Metabolism Diabetes Peptides & Proteins Recombinant Proteins Cell Biology Obesity Cell Culture Cytokines Cell Status Necrosis Apoptosis
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
Sequence	ETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
NCBI	TNFSF18/AITRL
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Tumor necrosis factor ligand superfamily member 18,TNFSF18,Activation-inducible TNF-related ligand,Glucocorticoid-induced TNF-related ligand,AITRL,GITRL,TL6
Similar products	GITRL, AITRL, TNFSF18, TL6, Tumor necrosis factor ligand superfamily member 18, Activation-inducible TNF-related ligand, Glucocorticoid-induced TNF-related ligand
Available
Manufacturer - Category	Proteins
Storage Conditions	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Immunogen	Glu74-Ser199
Route	C-6xHis
Endotoxin	< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Immune Checkpoint, TNF family
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP00912-50ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 10/9/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer