Comparison

Recombinant Human FGF-2/bFGF Protein European Partner

Item no. RP01042-5ug
Manufacturer Abclonal
Amount 5 ug
Quantity options 100 ug 10 ug 20 ug 50 ug 5 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE.
NCBI FGF-2/bFGF
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias BFGF,FGF-2,FGFB,HBGF-2,FGF2,FGF-2,FGFB,HBGF-2,Basic FGF,BFGF,fibroblast growth factor 2
Similar products HBGF-2, FGFB, FGF-2, BFGF
Shipping Condition Cool pack
Available
Manufacturer - Applications
< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
16.41 kDa
Description
Recombinant Human FGF-2/bFGF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Pro143-Ser288) of human FGF2 (Accession #NP_001997.5).
Immunogen
Pro143-Ser288
Route
No tag
Manufacturer - Research Area
Growth Factor, Cell Culture related
Revised name
BFGF, FGF-2, FGFB, HBGF-2
Antigen Seq
PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Bioactivity
1. Measured by its binding ability in a functional ELISA. Immobilized Human FGF2 at 0. 5 μg/mL (100 μL/well) can bind Human GPC3 with a linear range of 7-20 ng/mL.|2. Measured in a cell proliferation assay using BALB/c 3T3 mouse embryonic fibroblasts. The ED50 for this effect is typically 0. 635-2. 54 ng/mL, corresponding to a specific activity of 3. 94 × 105~1. 57 × 106 units/mg.|3. Recombinant Human VEGFA(40 ng/mL, Cat. RP01162) and bFGF(50 ng/mL) induce mesoderm cells to differentiate into hematopoietic stem and progenitor cells. After 4 days induction, pebbly-like CD43+ hematopoietic stem and progenitor cells appeared in the hematogenic endothelium.|4. The primary neural stem cells were cultured with 20 ng/mL bFGF and observed every 24 h. Results showed that the particle size of the suspended neural stem cells gradually increased.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of 20mM Tris,150 mM NaCl, pH7.5.Contact us for customized product form or formulation.
Expected Protein Size
16.41 kDa
Gene Symbol
FGF-2/bFGF

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 5 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close