« Back
Home /
Recombinant Mouse Pro-EGF Protein

Recombinant Mouse Pro-EGF Protein

Item no.	RP01045-20ug
Manufacturer	Abclonal
Amount	20 ug
Quantity options	100 ug 10 ug 200 ug 20 ug 50 ug
Category	Oncology Neuroscience Neural Signaling By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines
Type	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Host	Mouse
Purity	> 95% by SDS-PAGE.
Sequence	WQTGNCQPGPLERSERSGTCAGPAPFLVFSQGKSISRIDPDGTNHQQLVVDAGISADMDIHYKKERLYWVDVERQVLLRVFLNGTGLEKVCNVERKVSGLAIDWIDDEVLWVDQQNGVITVTDMTGKNSRVLLSSLKHPSNIAVDPIERLMFWSSEVTGSLHRAHLKGVDVKTLLETGGISVLTLDVLDKRLFWVQDSGEGSHAYIHSCDYEGGSVRLIRHQARHSLSSMAFFGDRIFYSVLKSKAIWIANKHTG
NCBI	Pro-EGF
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	beta-urogastrone,EGF,epidermal growth factor (beta-urogastrone),epidermal growth factor,HOMG4,pro-epidermal growth factor,URG,Urogastrone
Similar products	EGF, Urogastrone, HOMG4, URG, beta-urogastrone, epidermal growth factor, pro-epidermal growth factor, epidermal growth factor (beta-urogastrone)
Available
Manufacturer - Category	Proteins
Storage Conditions	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Immunogen	Trp29-Arg1029
Route	C-His
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Growth Factor, Cell Culture related
Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse pro-EGF at 200 ng/mL (100 μL/well) can bind Recombinant Human EGFR with a linear range of 5-12 ng/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP01045-20ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer