« Back
Home /
Recombinant Mouse c-Kit ligand/KITLG/SCF Protein

Recombinant Mouse c-Kit ligand/KITLG/SCF Protein

Item no.	RP01055-200ug
Manufacturer	Abclonal
Amount	200 ug
Quantity options	100 ug 10 ug 200 ug 20 ug 50 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Host	Mouse
Purity	> 95% by SDS-PAGE.
NCBI	c-Kit ligand/SCF/KITLG
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	KITLG,FPH2,KL-1,Kitl,MGF,SCF,SF,SHEP7,KL,SCF/KITLG
Similar products	SCF, KITLG, KL, MGF, Kitl, SF, FPH2, KL-1, SHEP7
Shipping condition	Cool pack
Available
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	19.14 kDa
Description	Recombinant Mouse c-Kit ligand/KITLG/SCF Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Lys26-Ala189) of mouse SCF (Accession #NP_038626.1.) fused with a 6×His tag at the C-terminus.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Lys26-Ala189
Route	C-His
Manufacturer - Research Area	Cytokines & Cytokine receptors, Cell Culture related
Revised name	KITLG, FPH2, KL-1, Kitl, MGF, SCF, SF, SHEP7, KL
Antigen Seq	KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
Bioactivity	1. Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 0. 5-1. 0 ng/mL, corresponding to a specific activity of 1. 0×10⁶-2. 0×10⁶ units/mg.\|2. Measured by its binding ability in a functional ELISA.Immobilized recombinant Mouse SCF at 2 μg/mL (100 μL/well) can bind recombinant human CD117 with a linear range of 1. 5-10 ng/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	19.14 kDa
Gene Symbol	c-Kit ligand/SCF/KITLG

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ug

available

Delivery expected until 7/31/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail