« Back
Home /
Recombinant Mouse Dkk-1 Protein

Recombinant Mouse Dkk-1 Protein

Item no.	RP01062-5ug
Manufacturer	Abclonal
Amount	5 ug
Quantity options	100 ug 10 ug 20 ug 50 ug 5 ug
Category	Oncology By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Host	Mouse
Purity	> 87% by SDS-PAGE.
NCBI	Dkk-1
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	DKK1,SK,Dickkopf-1,DKK1,DKK1,SK,DKK1
Similar products	DKK1, SK, Dickkopf-1
Shipping Condition	Cool pack
Available
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	30.13 kDa
Description	Recombinant Mouse Dkk-1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Met1-His272) of mouse Dkk-1 (Accession #NP_034181.2. ) fused with a 6×His tag at the C-terminus.
Immunogen	Met1-His272
Route	C-His
Manufacturer - Research Area	Other Recombinant Protein
Revised name	DKK1, SK, Dickkopf-1
Antigen Seq	MMVVCAAAAVRFLAVFTMMALCSLPLLGASATLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQASNSSRLHTCQRH
Bioactivity	Measured by its binding ability in a functional ELISA.Immobilized Mouse DKK-1 at 5 μg/mL (100 μL/well) can bind Human LRP-5 with a linear range of 1-399 ng/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	30.13 kDa
Gene Symbol	Dkk-1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP01062-5ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 5 ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer