« Back
Home /
Recombinant human BTN3A1/CD277 Protein

Recombinant human BTN3A1/CD277 Protein

Item no.	RP01067-50ug
Manufacturer	Abclonal
Amount	50 ug
Quantity options	100 ug 10 ug 200 ug 20 ug 500 ug 50 ug
Category	Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins Butyrophilins Other Lipid\Cholesterol Metabolism Modulators
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 97% by SDS-PAGE.
Sequence	QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG
NCBI	BTN3A1/CD277
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	BTN3A1,BT3.1,BTF5,BTN3.1,CD277
Similar products	BTN3A1, BTF5, CD277
Shipping Condition	Cool pack
Available
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	50.94 kDa
Manufacturer - Additional Information	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant human BTN3A1/CD277 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln30-Gly254) of human BTN3A1/CD277 (Accession #NP_919423.1) fused with an Fc, 6×His tag at the C-terminus.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Gln30-Gly254
Route	C-hFc&His
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Immune Checkpoint, Bio-Markers & CD Antigens
Antigen Seq	QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG
Bioactivity	Measured by its ability to inhibit Anti-CD3-induced proliferation of jurkat. The ED₅₀ for this effect is 24-96 ng/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	50.94 kDa
Gene Symbol	BTN3A1/CD277

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP01067-50ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 9/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer