Comparison

Recombinant Human Serum amyloid A-1/SAA1 Protein European Partner

Item no. RP01095-50ug
Manufacturer Abclonal
Amount 50 ug
Quantity options 1000 ug 10 ug 500 ug 50 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE.
Sequence RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAADEWGRSGKDPNHFRPAGLPEKY
NCBI Serum amyloid A-1/SAA1
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias SAA1,PIG4,SAA,SAA2,TP53I4
Similar products SAA1, SAA, Serum Amyloid A-1 Protein
Shipping Condition Cool pack
Available
Manufacturer - Applications
< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
13.2 kDa
Manufacturer - Additional Information
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Human Serum amyloid A-1/SAA1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Arg19-Tyr122) of human SAA1 (Accession #P0DJI8) fused with a 6×His tag at the N-terminus.
Background
This protein is a member of the serum amyloid A family of apolipoproteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a major acute phase protein that is highly expressed in response to inflammation and tissue injury. This protein also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of this protein are associated with chronic inflammatory diseases including atherosclerosis, rheumatoid arthritis, Alzheimer' s disease and Crohn' s disease. This protein may also be a potential biomarker for certain tumors. Alternate splicing results in multiple transcript variants that encode the same protein. A pseudogene of this gene is found on chromosome 11.
Manufacturer - Cross Reactivity
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Arg19-Tyr122
Route
N-His
Endotoxin
< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Biosimilar Drug Targets
Antigen Seq
RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAADEWGRSGKDPNHFRPAGLPEKY
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 1mM EDTA, pH 8.0.Contact us for customized product form or formulation.
Expected Protein Size
13.2 kDa
Gene Symbol
Serum amyloid A-1/SAA1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close