Comparison

Recombinant Human IL-20RB Protein European Partner

Item no. RP01102-50ug
Manufacturer Abclonal
Amount 50 ug
Quantity options 1000 ug 10 ug 500 ug 50 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE.
Dry ice Yes
Sequence DEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEA
NCBI IL-20RB
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias IL20RB,DIRS1,FNDC6,IL-20R2
Similar products IL-20RB, hCG_2022374, DIRS1, FNDC6, MGC34923, fibronectin type III domain containing 6, interleukin-20 receptor II, Interleukin-20 receptor subunit beta, IL-20 receptor subunit beta, IL-20R-beta, IL20R2
Shipping Condition Dry ice
Available
Manufacturer - Applications
< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
dry ice
Storage Conditions
Store at -70°C. This product is stable at ≤ -70°C for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Protein Weight
49.6 kDa
Manufacturer - Additional Information
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Human IL-20RB Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Asp30-Ala230) of human IL-20RB (Accession #Q6UXL0) fused with an Fc tag at the C-terminus.
Background
IL20RB and IL20RA (MIM 605620) form a heterodimeric receptor for interleukin-20 (IL20; MIM 605619) (Blumberg et al., 2001 [PubMed 11163236]).
Manufacturer - Cross Reactivity
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Asp30-Ala230
Route
C-Fc
Endotoxin
< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Interleukin
Antigen Seq
DEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEA
Protein Formulation
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
49.6 kDa
Gene Symbol
IL-20RB

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close