« Back
Home /
Recombinant Human Renin/REN Protein

Recombinant Human Renin/REN Protein

Item no.	RP01175-20ug
Manufacturer	Abclonal
Amount	20 ug
Quantity options	100 ug 10 ug 200 ug 20 ug 50 ug
Category	Peptides & Proteins Recombinant Proteins Cardiovascular Research Heart Failure Myocardial Infarction Hypertension
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 97% by SDS-PAGE.
Sequence	LPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGS
NCBI	Renin/REN
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	HNFJ2,REN,renin,Renin
Similar products	REN, Renin, FLJ10761, HNFJ2, angiotensinogenase
Shipping Condition	Cool pack
Available
Manufacturer - Category	Other Recombinant Protein
Shipping Temperature	ice pack
Storage Conditions	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturer - Additional Information	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant Human Renin/REN Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu24-Arg406) of human Renin (Accession #NP_000528.1.) fused with a 8xHis tag at the C-terminus.
Immunogen	Leu24-Arg406
Route	C-His
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Other Recombinant Protein
Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Human REN Protein at 0. 5 μg/mL (100 μL/well) can bind Renin Rabbit pAb with a linear range of 1. 9-302. 7 ng/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP01175-20ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer