« Back
Home /
Recombinant human CD177 Protein

Recombinant human CD177 Protein

Item no.	RP01202-5ug
Manufacturer	Abclonal
Amount	5 ug
Quantity options	100 ug 10 ug 20 ug 50 ug 5 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 97% by SDS-PAGE.
NCBI	CD177
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD177,HNA-2a,HNA2A,NB1,NB1 GP,PRV-1,PRV1,NB1GP
Similar products	CD177, HNA2A, NB1, PRV1, PRV-1, HNA-2a, NB1 GP
Shipping Condition	Cool pack
Available
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	70.22 kDa
Description	Recombinant Human CD177 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Gly407) of human CD177 (Accession #NP_065139.2.) fused with a Fc, 6×His tag at the C-terminus.
Immunogen	Met1-Gly407
Route	C-hFc&His
Manufacturer - Research Area	Bio-Markers & CD Antigens
Revised name	CD177, HNA-2a, HNA2A, PRV-1, PRV1, NB1, NB1 GP
Antigen Seq	MSPVLLLALLGFILPLPGVQALLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASYTHFCSSDLCNSASSSSVLLNSLPPQAAPVPGDRQCPTCVQPLGTCSSGSPRMTCPRGTTHCYDGYIHLSGGGLSTKMSIQGCVAQPSSFLLNHTRQIGIFSAREKRDVQPPASQHEG
Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Human PDPN(Catalog: RP00208 ) at 5μg/mL (100 μL/well) can bind Human CD177(Catalog: RP01202) with a linear range of 6. 8-250. 6 ng/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	70.22 kDa
Gene Symbol	CD177

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP01202-5ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 5 ug

available

Delivery expected until 9/11/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer