« Back
Home /
Recombinant human CD24 Protein

Recombinant human CD24 Protein

Item no.	RP01229-10ug
Manufacturer	Abclonal
Amount	10 ug
Quantity options	1000 ug 100 ug 10 ug 200 ug 20 ug 500 ug 50 ug
Category	Oncology Peptides & Proteins Recombinant Proteins Cell Biology Cell Movement Cell Adhesion By Organ Breast Cancer Heart & Blood Cancer
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 97% by SDS-PAGE.
Sequence	MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAG
NCBI	CD24
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD24,CD24A,CD24 molecule,CD247
Similar products	CD24, CD24A
Shipping Condition	Cool pack
Available
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	31.85 kDa
Manufacturer - Additional Information	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant Human CD24 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Gly59) of human CD24 (Accession #NP_037362) fused with a Fc tag at the C-terminus.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Met1-Gly59
Route	C-hFc
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Immune Checkpoint, Bio-Markers & CD Antigens
Antigen Seq	MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAG
Bioactivity	Measured by its binding ability in a functional ELISA.Immobilized Human CD24 at 2 μg/mL (100 μL/well) can bind Human Siglec10 with a linear range of 1-764 ng/mL.\|2. Measured by its binding ability in a functional ELISA.Immobilized PE Mouse Anti-Human CD24 at 1μg/mL (25 μL/well) can bind Human CD24 with a linear range of 0. 46-28. 4ng/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	31.85 kDa
Gene Symbol	CD24

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP01229-10ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer