Comparison

Recombinant Human IL-12/IL-12A&IL-12B Protein European Partner

Item no. RP01232-20ug
Manufacturer Abclonal
Amount 20 ug
Quantity options 100 ug 10 ug 200 ug 20 ug 50 ug 5 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE.
Sequence IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQV
NCBI IL-12A&IL-12B
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias CLMF,IL12,p70,Interleukin-12,IL12A,P35,NKSF
Similar products IL12A, p70, IL12, Interleukin-12, P35, CLMF, NKSF
Shipping Condition Cool pack
Available
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
25.54 kDa(IL-12A), 35.54 kDa(IL-12B)
Manufacturer - Additional Information
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Active Recombinant Human IL-12A&IL-12B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile23-Ser328&Arg23-Ser219) of human IL-12 (Accession #NP_002178.2/NP_000873.2) fused with a 6×His tag at the C-terminus(IL12B), Flag tag at the C-terminus(IL12A).
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Ile23-Ser328(IL12B)&Arg23-Ser219(IL12A)
Route
C-His(IL12B)&C-Flag(IL12A)
Endotoxin
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Interleukin
Antigen Seq
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS//RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Bioactivity
1. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human IL-12 at 1 μg/mL (100 μL/well) can bind Recombinant Human IL12Rβ1 with a linear range of 30. 6-122. 4 ng/mL.|2. Measured in a cell proliferation assay using anti-CD3 antibody activated Human T lymphocyte leukemia cells (jurkat). The ED50 for this effect is typically 0. 1-0. 4 ng/mL, corresponding to a specific activity of 2. 5×106-1. 0×107units/mg.|3. Measured by its ability to induce Interferon gamma secretion by human natural killer lymphoma NK-92 cells. The ED50 for this effect is 2-8 ng/mL, corresponding to a specific activity of 1. 25×105~5×105 units/mg.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
25.54 kDa(IL-12A), 35.54 kDa(IL-12B)
Gene Symbol
IL-12A&IL-12B

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close