Comparison

Recombinant Human/Mouse/Rat BDNF Protein European Partner

Item no. RP01243-10ug
Manufacturer Abclonal
Amount 10 ug
Quantity options 100 ug 10 ug 20 ug 50 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE.
Sequence HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
NCBI BDNF
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias ANON2,BULN2,BDNF,BULN2
Shipping Condition Cool pack
Available
Manufacturer - Applications
< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
14.35 kDa
Manufacturer - Additional Information
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Human/Mouse/Rat BDNF Protein is produced by E. coli expression system. The target protein is expressed with sequence (His129-Arg247) of human BDNF (Accession #NP_733929.1.) fused with an initial Met at the N-terminus and a 6×His tag at the C-terminus.
Background
Brain-derived neurotrophic factor (BDNF) is a member of the nerve growth factor family.The neurotrophin family is comprised of at least four proteins including NGF, BDNF, NT-3, and NT-4/5. These secreted cytokines are synthesized as prepropeptides that are proteolytically processed to generate the mature proteins.BDNF cDNA encodes a 247 amino acid residue precursor protein with a signal peptide and a proprotein that are cleaved to yield the 119 amino acid residue mature BDNF. The amino acid sequence of mature BDNF is identical in all mammals examined. BDNF binds with high affinity and specifically activates the TrkB tyrosine kinase receptor .
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
His129-Arg247
Route
C-His
Endotoxin
< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Growth Factor, Cell Culture related
Antigen Seq
HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Bioactivity
1. Measured by its binding ability in a functional ELISA.Immobilized Recombinant Human BDNF at 1 μg/mL (100 μL/well) can bind BDNF Rabbit mAb with a linear range of 0. 4-2. 15ng/mL.|2. Measured by its binding ability in a functional ELISA.Immobilized Recombinant Human TrkB at 2 μg/mL (100 μL/well) can bind Recombinant Human BDNF with a linear range of 1. 95-258 ng/mL.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
14.35 kDa
Gene Symbol
BDNF

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close