« Back
Home /
Recombinant SARS-CoV-2 Spike S2 ECD Protein

Recombinant SARS-CoV-2 Spike S2 ECD Protein

Item no.	RP01267-100ug
Manufacturer	Abclonal
Amount	100 ug
Quantity options	1000 ug 100 ug 1 mg
Category	Infectious Diseases Viral Infections Coronavirus (COVID-19) Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	SARS-CoV-2
Host	SARS-CoV-Infected Cells
Conjugate/Tag	HIS
Purity	> 90% by SDS-PAGE.
Sequence	SVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSS
NCBI	SARS-CoV-2 Spike S2 ECD
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Envelope,SARS-CoV-2 Spike RBD (N501Y),Spike,Spike ECD,Spike RBD,Spike S1,Spike S2,Spike S2 ECD,S1-RBD protein,NCP-CoV RBD Protein,novel coronavirus RBD Protein,2019-nCoV RBD Protein,S glycoprotein Subunit1 RBD Protein
Shipping Condition	Cool pack
Available
Manufacturer - Applications	< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	58.8kDa
Manufacturer - Additional Information	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant SARS-CoV-2(2019-nCoV) Spike S2 ECD Protein is produced by Baculovirus-Insect Cells expression system. The target protein is expressed with sequence (Ser686-Pro1213) of SARS-COV-2(2019-nCoV) Spike S2 ECD (Accession #YP_009724390.1) fused with a His tag at the C-terminus.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Ser686-Pro1213
Protein Size	58.8kDa
Route	C-His
Endotoxin	< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Research Area	SARS-CoV-2 antigens
Antigen Seq	SVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWP
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of sterile 20 mM PB, 300 mM NaCl, pH 7.0. or Supplied as a 0.22 μm filtered solution in 20 mM PB, 300 mM NaCl, pH 7.0Contact us for customized product form or formulation.
Expected Protein Size	58.8kDa
Gene Symbol	SARS-CoV-2 Spike S2 ECD

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP01267-100ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer