Comparison

Recombinant Human TNFRSF1A/TNF-R1/CD120a Protein European Partner

Item no. RP01347-10ug
Manufacturer Abclonal
Amount 10 ug
Quantity options 100 ug 10 ug 20 ug 50 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Purity > 95% by SDS-PAGE.
Sequence IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDC RECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLF QCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN VKGTEDSGTT
NCBI TNFRSF1A/TNF-R1/CD120a
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias TNFRSF1A,CD120a,FPF,TBP1,TNF-R,TNF-R-I,TNF-R55,TNFAR,TNFR1,TNFR55,TNFR60,p55,p55-R,p60
Shipping condition Cool pack
Available
Manufacturer - Applications
< 1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
22.08 kDa
Manufacturer - Additional Information
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Human TNFRSF1A/TNF-R1/CD120a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile22-Thr211) of human CD120a/TNFRSF1A (Accession #NP_001056.1) fused with 6×His tag at the C-terminus.
Background
The cluster of differentiation (CD) system is commonly used as cell markers in Immunophenotyping. Different kinds of cells in the immune system can be identified through the surface CD molecules which associating with the immune function of the cell. There are more than 320 CD unique clusters and subclusters have been identified. Some of the CD molecules serve as receptors or ligands important to the cell through initiating a signal cascade which then alter the behavior of the cell. Some CD proteins do not take part in cell signal process but have other functions such as cell adhesion. CD120a (cluste of differentiation 120a), also known as TNFR1 / TNFRSF1A, is a member of CD family, tumor necrosis factor receptor superfamily. CD120a is one of the most primary receptors for the tumor necrosis factor-alpha. It has been shown to be localized to both plasma membrane lipid rafts and the trans golgi complex with the help of the death domain (DD). CD120a can activate the transcription factor NF-κB, mediate apoptosis, and regulate inflammation processes.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Ile22-Thr211
Route
C-His
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
TNF family
Antigen Seq
IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDC RECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLF QCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN VKGTEDSGTT
Bioactivity
1. Measured by its binding ability in a functional ELISA.Immobilized Human TNFRSF1A at 2 μg/mL (100 μL/well) can bind Mouse TNFα with a linear range of 4-135 ng/mL.|2. Measured by its ability to inhibit TNFα-mediated cytotoxicity in the L929 mouse fibrosarcoma cells in the presence of metabolic inhibitor actinomycin D. The ED50 for this effect is typically 22-88ng/mL in the presence of 0. 25 ng/mL recombinant human TNFα.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Expected Protein Size
22.08 kDa
Gene Symbol
TNFRSF1A/TNF-R1/CD120a

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close