« Back
Home /
Recombinant Human TNFRSF10B/DR5/TRAIL-R2/CD262 Protein

Recombinant Human TNFRSF10B/DR5/TRAIL-R2/CD262 Protein

Item no.	RP01388-20ug
Manufacturer	Abclonal
Amount	20 ug
Quantity options	100 ug 10 ug 20 ug 50 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Purity	> 95% by SDS-PAGE.
Sequence	ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE
NCBI	TNFRSF10B/DR5/TRAIL-R2/CD262
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD262,DR5,KILLER,KILLER/DR5,TRAIL-R2,TRAILR2,TRICK2,TRICK2A,TRICK2B,TRICKB,ZTNFR9,TNFRSF10B
Shipping condition	Cool pack
Available
Manufacturer - Applications	<0.1EU/μg
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	41.07 kDa
Manufacturer - Additional Information	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Active Recombinant Human TNFRSF10B/DR5/TRAIL-R2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile56-Glu182) of human DR5/TRAIL R2 (Accession #NP_003833.3) fused with a Fc, 6×His tag at the C-terminus.
Background	This protein is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Ile56-Glu182
Route	C-hFc&His
Endotoxin	<0.1EU/μg
Manufacturer - Research Area	Bio-Markers & CD Antigens, TNF family, Biosimilar Drug Targets
Antigen Seq	ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE
Bioactivity	1. Measured by its binding ability in a functional ELISA.Immobilized Human TNFRSF10B at 1 μg/mL (100 μL/well) can bind Human TNFSF10 with a linear range of 0. 1-11. 7 ng/mL.\|2. Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L_x001e_929 mouse fibroblast cells treated with TRAIL. The ED₅₀ for this effect is 30-120 pg/mL in the presence of 20 ng/mL Recombinant Human TRAIL/TNFSF10.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Expected Protein Size	41.07 kDa
Gene Symbol	TNFRSF10B/DR5/TRAIL-R2/CD262

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 6/5/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Recommend by mail