Comparison

Recombinant Mouse IL-13 Protein European Partner

Item no. RP01596-20ug
Manufacturer Abclonal
Amount 20 ug
Quantity options 100 ug 10 ug 20 ug 50 ug
Category
Type Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Purity > 95% by SDS-PAGE.
Sequence SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
NCBI IL-13
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Interleukin-13,IL-13,T-Cell Activation Protein P600,Il13,Il-13,IL13,Interleukin-13,IL-13,T-Cell Activation Protein P600,Il13,Il-13,IL13
Shipping Condition Cool pack
Available
Manufacturer - Applications
<0.1EU/μg
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
12.52 kDa
Manufacturer - Additional Information
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Mouse IL-13 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser26-Phe131) of mouse IL-13 (Accession #NP_032381.1) fused with and a 6×His tag at the C-terminus.
Background
Mouse interleukin 13 (mIL-13) is a pleiotropic cytokine produced by activated Th2 cells. IL-13 induces B cell proliferation and immunoglobin production. It contains a four helical bundle with two internal disulfide bonds. Mouse IL13 shares 58% sequence identity with human protein and exhibits cross-species activity. IL13 signals via receptor IL13R (type2, IL4R) and activates STAT-6. IL13 initially binds IL-13Rα1 with low affinity and triggers association of IL4R α , generating a high affinity heterodimeric receptor IL13R and eliciting downstream signals. IL13 also binds IL-13Rα2 with high affinity, which plays a role in a negative feedback system of IL13 signaling. IL13 is an important mediator of allergic inflammation and disease.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Ser26-Phe131
Recommended Dilution
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Route
C-His
Endotoxin
<0.1EU/μg
Manufacturer - Research Area
Cytokines & Cytokine receptors
Antigen Seq
SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
Bioactivity
Measured in a cell proliferation assay using TF-1 Mouse erythroleukemic cells.The ED50 for this effect is 5. 4-21. 4 ng/mL, corresponding to a specific activity of 4. 68×104~1. 85×105 units/mg.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Expected Protein Size
12.52 kDa
Gene Symbol
IL-13

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close