« Back
Home /
Recombinant Human FGF-9 Protein

Recombinant Human FGF-9 Protein

Item no.	RP01710-10ug
Manufacturer	Abclonal
Amount	10 ug
Quantity options	100 ug 10 ug 20 ug 50 ug
Category	Oncology Neuroscience Neural Signaling By Cell Type Carcinoma Hematology Myeloma Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Sequence	APLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
NCBI	FGF-9
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	GAF,FGF-9,SYNS3,HBFG-9,HBGF-9,FGF9
Shipping Condition	Cool pack
Available
Manufacturer - Applications	<1EU/μg
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	23.31 kDa
Manufacturer - Additional Information	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant Human FGF-9 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala2-Ser208) of human FGF-9 (Accession #NP_002001.1) fused with no additional amino acid.
Background	Fibroblast growth factor 9 (FGF9) also known as Glia-activating factor or Heparin-binding growth factor 9, is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Ala2-Ser208
Route	NO-tag
Endotoxin	<1EU/μg
Manufacturer - Research Area	Cytokines & Cytokine receptors
Antigen Seq	APLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Bioactivity	Measured in a cell proliferation assay using BALB/3T3 mouse fibroblasts. The ED₅₀ for this effect is 2. 34-9. 34 ng/mL, corresponding to a specific activity of 1. 07×10⁵~4. 27×10⁵ units/mg.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of 20mM PB, pH 6.0.
Expected Protein Size	23.31 kDa
Gene Symbol	FGF-9

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP01710-10ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 11/27/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer