Recombinant Rat IFN-gamma Protein

Proteins

Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.

Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.

Interferon-gamma (IFN-gamma ) is a secreted protein which belongs to the type II interferon family.Recombinant Human IFN-gamma is a 16.8 kDa protein containing 143 amino acid residues. IFN-gamma is produced by a variety of immune cells under inflammatory conditions, notably by T cells and NK cells. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. Interferon-gamma is a central regulator of the immune response and signals via the Janus Activated Kinase (JAK)-Signal Transducer and Activator of Transcription (STAT) pathway.

Gln23-Cys156

<0.01EU/μg

QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

IFN-gamma