Comparison

Recombinant Human CCL5/RANTES Protein European Partner

Item no. RP01750LQ-10ug
Manufacturer Abclonal
Amount 10 ug
Quantity options 100 ug 10 ug 20 ug 50 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Purity > 97% by SDS-PAGE.
Dry ice Yes
Sequence SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
NCBI CCL5/RANTES
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias SISd,eoCP,SCYA5,RANTES,TCP228,D17S136E,SIS-delta
Shipping Condition Dry ice
Available
Manufacturer - Applications
< 1EU/μg
Manufacturer - Category
Proteins
Shipping Temperature
dry ice
Storage Conditions
Store at -70°C. This product is stable at ≤ -70°C for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Protein Weight
8.69 kDa
Description
Recombinant Human CCL5/RANTES Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser24-Ser91) of human CCL5/RANTES (Accession #NP_002976.2) fused with and a 6×His tag at the C-terminus.
Background
Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor chemokine (C-C motif) receptor 5 (CCR5), and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. Alternative splicing results in multiple transcript variants that encode different isoforms.
Immunogen
Ser24-Ser91
Route
C-6His
Endotoxin
< 1EU/μg
Manufacturer - Research Area
Cytokines & Cytokine receptors
Antigen Seq
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human CCL5 (Catalog: RP01750LQ) at 5 μg/mL (100 μL/well) can bind Mouse CXCL4 (Catalog: RP03170) with a linear range of 10-252. 6 ng/mL.
Protein Formulation
Supplied as a 0.22 μm filtered solution in PBS, pH 7.4.
Expected Protein Size
8.69 kDa
Gene Symbol
CCL5/RANTES

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close