Comparison

Recombinant Human IL-21 Protein European Partner

Item no. RP02508-50ug
Manufacturer Abclonal
Amount 50 ug
Quantity options 100 ug 20 ug 50 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Purity > 95% by SDS-PAGE.
Sequence MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
NCBI IL-21
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias IL21,CVID11,IL-21,Za11
Shipping Condition Cool pack
Available
Manufacturer - Category
Interleukin, Cell Culture related, Biosimilar Drug Targets
Shipping Temperature
ice pack
Storage Conditions
Store the lyophilized protein at -20°C to -80°C for long term.|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Manufacturer - Additional Information
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Description
Recombinant Human IL-21 Protein is produced by Escherichia coli expression system. The target protein is expressed with sequence of Human IL-21 fused with polyhistidine tag at the C-terminus
Background
Interleukin-21 (IL21) belongs to the IL-15/IL-21 family. It is a cytokine with immunoregulatory activity. Cytokines are proteinaceous signaling compounds that are major mediators of the immune response. They control many different cellular functions including proliferation, differentiation and cell survival/apoptosis but are also involved in several pathophysiological processes including viral infections and autoimmune diseases. Interleukin-21 is a cytokine that has potent regulatory effects on cells of the immune system, including natural killer (NK) cells and cytotoxic T cells that can destroy virally infected or cancerous cells. This cytokine induces cell division/proliferation in its target cells.
Route
C-His
Endotoxin
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Interleukin, Cell Culture related, Biosimilar Drug Targets
Bioactivity
Measured by its ability to enhance IFN gamma secretion in NK-92 cells. The ED50 for this effect is <10 ng/mL.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close