« Back
Home /
Anti-PPOX Antibody

Anti-PPOX Antibody

Item no.	101-11303
Manufacturer	Raybiotech
Amount	200 ul
Quantity options	100 ug 200 ul 100 ug
Category	Metabolism Glucose Homeostasis Regulation of Appetite Antibodies Obesity Western Blot ELISA Primary Antibodies Immunostaining
Type	Antibody Monoclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	EASGCVLSQELFQQRAQEAAATQLGLKEMPSHCLVHLHKN CIPQYTLGHWQKLESARQFLTAHRLPLTLAGASYEGVAVN DCIESGRQAAVSVLGTEPNS
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Similar products	PPOX
Shipping Condition	Cool pack
Available
Manufacturer - Category	Antibodies\|Primary Antibodies
Shipping Temperature	Blue ice
Storage Conditions	-20°C
Description	Human PPOX monoclonal antibody (200 uL)
Gene Symbols	PPOX
UNSPSC Code	12352203
Protein Name & Synonyms	PPOX
Format	In ascites fluid
Manufacturer - Specificity	Human
Buffers	Ascites fluid
Expiration	12 months from the date of shipment when stored properly.
Clonality	Monoclonal

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

101-11303.pdf

101-11303-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ul

available

Delivery expected until 12/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time