« Back
Home /
Anti-Growth Hormone Polyclonal Antibody

Anti-Growth Hormone Polyclonal Antibody

Item no.	128-10223-2
Manufacturer	Raybiotech
Amount	20 ug
Quantity options	5 ug 20 ug 100 ug
Category	Metabolism Diabetes Antibodies Western Blot ELISA Primary Antibodies Immunostaining
Type	Antibody
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Purity	Greater than 98%.
Sequence	FPTI PLSRLFDNAM LRAHRLHQLAFDTYQ ,EFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNRE ETQQKSNLE ,LLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLL KDLEEGIQTLMGRLE DGSPRTGQIFKQ TYSK DTNSHNDDALLKNYGLLYCFRK DM DKVETFLRIVQCRSVEGSCGF
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Similar products	Growth
Shipping Condition	Room temperature
Available
Manufacturer - Applications	ELISA: to detect HGH by indirect ELISA, a dilution of at least 1/1, 000 of this antibody is required. This antibody, in conjunction with compatible secondary reagents (anti rabbit AP conjugated), allows the detection of 0.2-1 ng/well of HGH. Western Blot: to detect HGH by Western Blotting analysis this antibody can be used in a dilution of 1/1, 500.
Manufacturer - Category	Antibodies\|Primary Antibodies
Shipping Temperature	Ambient temperature
Storage Conditions	-20°C
UNSPSC Code	12352203
Formulation	Lyophilized from a sterile filtered (0.2µm) solution containing phosphate buffered saline.
Protein Name & Synonyms	Growth Hormone Polyclonal
Purification	Purified IgG prepared by affinity chromatography on protein G.
Expiration	12 months from the date of shipment when stored properly.
Clonality	Polyclonal
Immunogen	IgG Anti HGH has been developed in rabbit using highly pure (>98%) recombinant human HGH expressed in plants.
Solubility	Add distilled water at 1:2 ratio and let the lyophilized pellet dissolve completely.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.