« Back
Home /
Secreted Phospholipase A2-IID, Human Recombinant

Secreted Phospholipase A2-IID, Human Recombinant

Item no.	228-11269-2
Manufacturer	Raybiotech
Amount	10 ug
Quantity options	10 ug 1 mg
Category	Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins Cardiovascular Research Thrombosis & Hemostasis Enzymes Fatty Acid Catabolism
Type	Proteins Recombinant
Format	Lyophilized
Specific against	Human (Homo sapiens)
Host	E.coli
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Similar products	PLA2G2D
Shipping Condition	Room temperature
Available
Manufacturer - Category	Proteins and Peptides\|Recombinant Proteins
Shipping Temperature	Ambient temperature
Storage Conditions	-20°C
Format	Sterile Filtered lyophilized (freeze-dried) powder.
Formulation	Sterile filtered and lyophilized from 0.5 mg/ml in 0.05M Acetate buffer pH -4.
Expressed Region	MRGSHHHHHHGMASHMGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGR GQPKDATDWCCQTHDCCYDHLKTQGCGIYKYYRYNFSQGNIHCSDKGSWC EQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC.
Protein Name & Synonyms	Group IID secretory phospholipase A2, EC 3.1.1.4, Phosphatidylcholine 2-acylhydrolase GIID, GIID sPLA2, PLA2IID, sPLA(2)-IID, Secretory-type PLA, stroma-associated homolog, SPLASH, sPLA2S, PLA2G2D.
UNSPSC Code	12352202

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

228-11269-2.pdf

228-11269-2-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 9/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer