« Back
Home /
LR3 Insulin Like Growth Factor-1, Human Recombinant

LR3 Insulin Like Growth Factor-1, Human Recombinant

Item no.	228-11894-2
Manufacturer	Raybiotech
Amount	500 ug
Quantity options	500 ug 1 mg
Category	Metabolism Diabetes Glucose Homeostasis Cholesterol & Lipid Metabolism Regulation of Appetite Peptides & Proteins Recombinant Proteins Endocrine Regulation of Lipid Metabolism
Type	Proteins Recombinant
Format	Lyophilized
Specific against	Human (Homo sapiens)
Host	E.coli
Purity	Greater than 95.0% as determined by SDS-PAGE and HPLC.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Similar products	Long R3
Shipping Condition	Room temperature
Available
Manufacturer - Category	Proteins\|Recombinant Proteins\|Human Proteins
Shipping Temperature	Ambient temperature
Storage Conditions	-20°C
UNSPSC Code	12352202
Formulation	Lyophilized from a 0.2 um filtered concentrated solution in 1xPBS.
Expressed Region	MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA.
Protein Name & Synonyms	R3 IGF1, R3 IGF-1, R3IGF1, R3IGF-1, LONG IGF1, LONG IGF-1, LONG R3 IGF1, LONG R3IGF1, LONG R3 IGF-1, LONG R3IGF-1.
Format	Sterile Filtered White lyophilized (freeze-dried) powder.
Biological activity	The ED50 as determined by the stimulation of protein synthesis in L6 myoblasts is less than 10ng/ml, corresponding to a specific activity of 100, 000units/mg.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

228-11894-2.pdf

228-11894-2-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 12/11/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer