« Back
Home /
HIV-2 gp36 397aa Recombinant

HIV-2 gp36 397aa Recombinant

Item no.	228-10760-3
Manufacturer	Raybiotech
Amount	1000 ug
Quantity options	500 ug 1000 ug
Category	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid
Applications	ELISA
Specific against	other
Host	E.coli
Purity	Greater than 95.0% as determined by HPLC analysis and SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Similar products	gp36 (aa
Shipping Condition	Cool pack
Available
Specificity	Immunoreactive with all sera of HIV-2 infected individuals.
Manufacturer - Applications	HIV-2 gp-36 antigen in ELISA and Western blots, excellent antigen for early detection of HIV seroconvertors with minimal specificity problems.
Manufacturer - Category	Proteins and Peptides\|Recombinant Proteins
Shipping Temperature	Blue ice
Storage Conditions	4°C
Format	Sterile filtered colorless clear solution.
Formulation	0.01M Na2CO3, 0.01M Na3EDTA, 0.014 M(omega)-mercaptoethanol, 0.02% Sarcosyl.
Expressed Region	EQTMVQDDPSTCRGEFLYCNMTWFLNWIENKTHRNYAPCHIKQIINTWHKVGRNVYLPPREGELSCNSTVTSIIANIDWQNNNQTNITFSAEVAELYRLELGDYKLVEITPIGFAPTKEKRYSSAHGRHTRGVFVLGFLGFLATAGSAMGAASLTVSAQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQARVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDSLAPDWDNMTWQEWEKQVRYLEANISKSLEQAQIQQEKNMYELQKLNSWDIFGNWFDLTSWVKYIQYGVLIIVAVIALRIVIYVVQMLSRLRKGYRPVFSSPPGYIQQIHIHKDRGQPANEETEEDGGSNGGDRYWPWPIAYIHFLIRQLIRLLTRLYSICSQAC.
UNSPSC Code	12352202
Manufacturer - Specificity	Immunoreactive with all sera of HIV-2 infected individuals.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

228-10760-3.pdf

228-10760-3-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1000 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer