Comparison

Interleukin-1 beta, Rat Recombinant

Item no. 228-10849-2
Manufacturer Raybiotech
Amount 10 ug
Quantity options 10 ug 1 mg
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Rat (Rattus norvegicus)
Host E.coli
Purity Greater than 97.0% as determined by SDS-PAGE.
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Similar products IL-1 beta
Shipping Condition Room temperature
Available
Manufacturer - Category
Proteins|Recombinant Proteins|Animal Proteins
Shipping Temperature
Ambient temperature
Storage Conditions
-20°C
UNSPSC Code
12352202
Formulation
The protein was lyophilized from 0.2um filtered concentrated solution in PBS, pH 7.4.
Expressed Region
MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS.
Protein Name & Synonyms
Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.
Format
Sterile Filtered White lyophilized (freeze-dried) powder.
Biological activity
The ED50 was found to be less than 0.1ng/ml, determined by the dose dependent proliferation of mouse D10S cells, corresponding to a specific activity of 10, 000, 000 units/mg.
Protein Content
Protein quantitation was carried out by two independent methods:1. UV spectroscopy at 280 nm using the absorbency value of 0.558 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics). 2. Analysis by RP-HPLC, using a standard solution of IL-1b as a Reference Standard.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close