Comparison

Muscarinic Toxin 3 European Partner

Item no. ALO-M-140-0.25mg
Manufacturer Alomone
Amount 0.25 mg
Quantity options 0.1 mg 0.25 mg 0.5 mg 1 mg 50 ug 5 mg
Category
Type Chemicals
Format Lyophilized
Specific against other
Purity >99% (HPLC)
Formula Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Sequence LTCVTKNTIFGITTENCPAGQNLCFKRWHYVIPRYTEITRGCAATCPIPENYDSIHCCKTDKCNE-OH
ECLASS 10.1 32160000
ECLASS 11.0 32160000
UNSPSC 12000000
Shipping Condition Room temperature
Available
Manufacturer - Type
Non Antibodies
Manufacturer - Applications
Calcium imaging assay
Manufacturer - Category
Proteins
Manufacturer - Targets
M1, M4 muscarinic receptors, adrenoceptors
Country of Origin
Israel
Shipping Temperature
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Storage Conditions
Storage as Solution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. - Storage before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. - Storage after Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Molecular Weight
7379 Da
Manufacturer - Format
Lyophilized
Short description
An Antagonist of M1 and M4 Muscarinic Receptors and Adrenoceptors
Description
MT3, MT-3 - An Antagonist of M1 and M4 Muscarinic Receptors and Adrenoceptors
Reconstitution
Centrifuge the vial (10, 000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Specificity

An Antagonist of M1 and M4 Muscarinic Receptors and Adrenoceptors

PH
7, 4
UNSPSC
12352202
Origin
Dendroaspis angusticeps (Eastern green mamba).
Modifications
Disulfide bonds between: Cys3-Cys24, Cys17-Cys42, Cys46-Cys57and Cys58-Cys63
Effective Concentration
100 nM - 1 μM
Activity
Muscarinic receptor 4 and adrenoceptor antagonist1-4.
Solubility
Centrifuge the vial before adding solvent (10, 000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Sterile endotoxin free
no
Bioassay tested
yes
Scientific Background
Muscarinic toxins are isolated from the venom of the mamba species and are composed of 65 to 66 amino acid residues with four intramolecular disulfide bridges. One of these is muscarinic toxin 3 (MT-3) which was isolated from the green mamba (Dendroaspis augusticeps) and is composed of 65 amino acid residues1. A recent study investigated the interaction of MT3 with cloned receptors (mAChRs and adrenoceptors) expressed in insect cells by radioligand binding. MT3 appears to have a broad spectrum of targets showing high-affinity binding (IC50 = 1-10 nM) to M4 mAChR, α1A-, α1D- and α2A-adrenoceptors and lower affinity binding (IC50 > 25 nM) to α1B- and α2C-adrenoceptors and M1 mAChR2.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 0.25 mg
Available: In stock
available

Delivery expected until 12/4/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close